Find Jobs
Hire Freelancers

Neuro fuzzy systems

$30-250 USD

Kapalı
İlan edilme: 7 yıldan fazla önce

$30-250 USD

Teslimde ödenir
I need someone to design a neurofuzzy system for protein secondary structure prediction. Given a protein sequence it should output the secondary sequence of that protein sequence For example if the protein sequence is KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG the secondary structure should be CCCHHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCEECCCCCCEEEEEEECCCCEECCCCEEC.
Proje No: 11760381

Proje hakkında

9 teklif
Uzaktan proje
Son aktiviteden bu yana geçen zaman 8 yıl önce

Biraz para mı kazanmak istiyorsunuz?

Freelancer'da teklif vermenin faydaları

Bütçenizi ve zaman çerçevenizi belirleyin
Çalışmanız için ödeme alın
Teklifinizin ana hatlarını belirleyin
Kaydolmak ve işlere teklif vermek ücretsizdir
9 freelancer bu proje için ortalama $317 USD teklif veriyor
Kullanıcı Avatarı
sir i can help u with this project i have done masters in computer engg with specilization in image processing and pattern recognition this is a dummy bid i can give u an exact estimate after we discuss the project hopping for your kind consideration
$155 USD 3 gün içinde
4,9 (102 değerlendirme)
6,1
6,1
Kullanıcı Avatarı
Hi i can help you in this project. I have done projects on fuzzy logic. kindly share some more details so that i can further guide you. Thanks for considering my bid.
$222 USD 7 gün içinde
4,9 (15 değerlendirme)
4,9
4,9
Kullanıcı Avatarı
I am an expert in data mining and predictive modeling. I have a PhD in Physics and I have extensive experience in machine learning applications, statistics and software development (web, mobile, desktop, SaaS). I work with R, Python, Spark, SQL, noSQL, Hadoop, .NET, Java, Angular JS, Quantopian, C#, and Tableau.
$800 USD 12 gün içinde
5,0 (5 değerlendirme)
4,4
4,4
Kullanıcı Avatarı
Hi! Im an electrical and electronic masters student studying in UWE. I have the experience of programming in C/C++/Assembly/Arduino/PIC C/MikroC/MATLAB for more than three years. I also have the knowledge and experience of ELECTRICAL AND ELECTRONICS circuit analysis and design. I also have experience in embedded systems using microcontrollers like PIC, ATMEL, ARDUINO and most of the other types. I have made different kinds of devices varying from radios to drones and more. I am very keen to work on implementation projects I also have studied Artificial intelligence. Im very thorough with subjects like Neural networks, Fuzzy systems, Genetic algorithms and Expert Systems. I have done BCS (British computer society) diploma level. I have the knowledge on PHP/HTML5/mySQL for website development. I have completed many freelancer assignments successfully. If you are interested in hiring me, please send me a message. I have made a lot of reports in the recent past. I have good experience in using Microsoft office softwares like Word, Excel and Powerpoint. I can write reports of any length without mistakes. Thank you!
$135 USD 2 gün içinde
4,6 (14 değerlendirme)
4,0
4,0
Kullanıcı Avatarı
Hi, I have read and understood the project description and possess the skills required to meet your needs. Please give me a chance and reply. Thanks.
$833 USD 10 gün içinde
4,0 (6 değerlendirme)
4,0
4,0
Kullanıcı Avatarı
I have M.Sc. in engineering and more than 10 years of experience as an engineer and researcher. More than 40 papers, seven books, and one standard. In my profile, I attached some of my papers and books and samples of my previous projects in Freelancer. I am professional in your task, and I can complete your project on time, but first, I need to know more about your task. The most important thing for me in Freelancer is to do the clients projects correct and in time. I look forward to hearing from you!
$200 USD 7 gün içinde
5,0 (1 değerlendirme)
2,0
2,0
Kullanıcı Avatarı
Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Processing, wireless sensor network, routing protocol, electrical & electronics engineering and communication system.
$155 USD 3 gün içinde
0,0 (0 değerlendirme)
0,0
0,0
Kullanıcı Avatarı
Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Processing, wireless sensor network, routing protocol, electrical & electronics engineering and communication system.
$155 USD 3 gün içinde
0,0 (0 değerlendirme)
0,0
0,0

Müşteri hakkında

   UNITED STATES bayrağı
Dover, United States
1,0
1
Eyl 19, 2016 tarihinden bu yana üye

Müşteri Doğrulaması

Teşekkürler! Ücretsiz kredinizi talep etmeniz için size bir bağlantı gönderdik.
E-postanız gönderilirken bir şeyler yanlış gitti. Lütfen tekrar deneyin.
Kayıtlı Kullanıcı İlan Edlien Toplam İş
Freelancer ® is a registered Trademark of Freelancer Technology Pty Limited (ACN 142 189 759)
Copyright © 2024 Freelancer Technology Pty Limited (ACN 142 189 759)
Ön izleme yükleniyor
Coğrafik konum için izin verildi.
Giriş oturumunuzun süresi doldu ve çıkış yaptınız. Lütfen tekrar giriş yapın.